PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA03G0015400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 232aa    MW: 26366.1 Da    PI: 9.3707
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA03G0015400.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.83.7e-30959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  ORGLA03G0015400.1  9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 59
                       79***********************************************86 PP

2K-box70.93.9e-2478171699
              K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                        g+++ +++ e+ + +++ L k++e L++ +R+llGe+L+++s++eL++Le +Le+sl +iR +K++ll eq+ +l++ke +l+++n++Lr+k
  ORGLA03G0015400.1  78 GNKTVQQDIEQVKADADGLAKKLEALETYKRKLLGEKLDECSIEELHSLEVKLERSLISIRGRKTKLLEEQVAKLREKEMKLRKDNEELREK 169
                        4557788899*********************************************************************************9 PP

              K-box  98 le 99 
                         +
  ORGLA03G0015400.1 170 CK 171
                        76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.735161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-33384IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-31323IPR002100Transcription factor, MADS-box
CDDcd002651.11E-42374No hitNo description
PfamPF003192.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-313859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-2483171IPR002487Transcription factor, K-box
PROSITE profilePS5129713.41386176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGKLYEFASA  60
STQKTIERYR TYTKENIGNK TVQQDIEQVK ADADGLAKKL EALETYKRKL LGEKLDECSI  120
EELHSLEVKL ERSLISIRGR KTKLLEEQVA KLREKEMKLR KDNEELREKC KNQPPLSAPL  180
TVRAEDENPD RNINTTNDNM NMDVETELSI GLPGRSRSSG GAAEDSQAMP HS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-19372271Myocyte-specific enhancer factor 2A
3mu6_C2e-19372271Myocyte-specific enhancer factor 2A
3mu6_B2e-19372271Myocyte-specific enhancer factor 2A
3mu6_A2e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8300370.0CT830037.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA030D10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630979.11e-165PREDICTED: MADS-box transcription factor 50
SwissprotQ9XJ601e-167MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLI1P7081e-170I1P708_ORYGL; Uncharacterized protein
STRINGORGLA03G0015400.11e-169(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-69AGAMOUS-like 20